PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC429_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 273aa    MW: 31184.2 Da    PI: 9.3201
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC429_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.84.7e-3854112462
     zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                k+++cprC+s++tkfCyynny+++qPr+fCkaC+ryWt GG++r vPvG+grrknk++s
  RrC429_p2  54 KIIPCPRCNSMETKFCYYNNYNVNQPRHFCKACQRYWTSGGTMRSVPVGAGRRKNKNNS 112
                7899****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-3538107IPR003851Zinc finger, Dof-type
PfamPF027011.9E-3155110IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.2256110IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105894IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MLERKDQAIK LFGMKIPLPT VLEAEEDGIS KEKNQNETLN DQVEKDKTLK KPIKIIPCPR  60
CNSMETKFCY YNNYNVNQPR HFCKACQRYW TSGGTMRSVP VGAGRRKNKN NSSSCSHNYH  120
HATISETRNP VLSFTHGDDQ NVSNNRITHS WPYMWNPGFY PVYPYWNVPM LSPSPNSSPK  180
STIGKHSRDE DETVKQKQRN VSVLVPKTLR VDDPNEAAKS SIWTTLGIKN EVMFKGFDSK  240
KEVTIDKEET ETSLVLCANP AALSRSANFH ERL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895971e-109AC189597.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH014E13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013646992.11e-175PREDICTED: cyclic dof factor 1-like
SwissprotQ8W1E31e-149CDF1_ARATH; Cyclic dof factor 1
TrEMBLA0A078JQK11e-175A0A078JQK1_BRANA; BnaCnng61810D protein
TrEMBLA0A0D3BFS91e-175A0A0D3BFS9_BRAOL; Uncharacterized protein
STRINGBra010082.1-P1e-157(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139791625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.11e-142cycling DOF factor 1